PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009793182.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family Dof
Protein Properties Length: 269aa    MW: 29506.1 Da    PI: 9.3765
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009793182.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof98.54.4e-3179132659
          zf-Dof   6 lkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknk 59 
                     l+cprC+stntkfCy+nnyslsqPryfC +C+r+WtkGG lr vP Gg rr++ 
  XP_009793182.1  79 LRCPRCESTNTKFCYFNNYSLSQPRYFCMTCKRHWTKGGGLRSVPEGGRRRRRI 132
                     78*********************************************9999865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-2359123IPR003851Zinc finger, Dof-type
PfamPF027016.4E-2978131IPR003851Zinc finger, Dof-type
PROSITE profilePS5088425.58379133IPR003851Zinc finger, Dof-type
PROSITE patternPS01361081117IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 269 aa     Download sequence    Send to blast
MVFSSNPAYL IPATNWQQND GSSSSNLQFL SAPSEPAPPP LPPPPPPSQP YAGAAGSTRP  60
RSMHEQARLA NIRMPLAVLR CPRCESTNTK FCYFNNYSLS QPRYFCMTCK RHWTKGGGLR  120
SVPEGGRRRR RIKLSNSNKN NNNNTSMSPA SSPKNDGLKA TTNNLGACNS NRFFGHVNSQ  180
TPPLRFMTPL GQLTEHYHYH YSTPSDNNSS LNYSAISSAA PVVDASIDSI QLEMEAQQFP  240
NLMGILDLSM PSGLYPSGEE IHSTGINII
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1125133GRRRRRIKL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009793182.10.0PREDICTED: dof zinc finger protein DOF2.4-like
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA1824134
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02460.15e-30Dof family protein